PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 488929
Common NameARALYDRAFT_488929
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24040.9 Da    PI: 9.6819
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
488929genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.52.3e-25958150
            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
            krien  nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+
  488929  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMVDYC 58
            79*********************************************997 PP

2K-box78.12.3e-2671168198
   K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
             yqk sgk+l++ak+e+l++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R++++ell ++ ++ ++ ++e+++ + +L+++ 
  488929  71 YQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVRDHQMELLNSKRRNVKMIMEEHRQLTFQLQQQD 168
             899********************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.361161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-37160IPR002100Transcription factor, MADS-box
CDDcd002657.01E-38280No hitNo description
SuperFamilySSF554558.37E-34296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-26323IPR002100Transcription factor, MADS-box
PfamPF003198.7E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-263859IPR002100Transcription factor, MADS-box
PfamPF014867.5E-1682164IPR002487Transcription factor, K-box
PROSITE profilePS5129713.64884170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMVDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKVRDHQM ELLNSKRRNV KMIMEEHRQL TFQLQQQDMA IASNARGMMM  180
RDHDGQFGYR VQPIQPNLQE KIMSLVID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J4e-16289180Myocyte-specific enhancer factor 2A
3p57_I4e-16289180Myocyte-specific enhancer factor 2A
3p57_D4e-16289180Myocyte-specific enhancer factor 2A
3p57_C4e-16289180Myocyte-specific enhancer factor 2A
3p57_B4e-16289180Myocyte-specific enhancer factor 2A
3p57_A4e-16289180Myocyte-specific enhancer factor 2A
3kov_J4e-16289180Myocyte-specific enhancer factor 2A
3kov_I4e-16289180Myocyte-specific enhancer factor 2A
3kov_B4e-16289180Myocyte-specific enhancer factor 2A
3kov_A4e-16289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHMADSBOX0.0D30807.1 Arabidopsis thaliana PISTILLATA mRNA for PI protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871931.11e-153pistillata
SwissprotP480071e-149PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLD7LZZ31e-153D7LZZ3_ARALL; Pistillata
STRINGfgenesh2_kg.6__2063__AT5G20240.11e-152(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-150MIKC_MADS family protein